Catalog# |
CD47 |
Source |
Human Cells |
Description |
Recombinant Human Interleukin-7/IL-7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp26-His177) of Human IL-7 fused with a polyhistidine tag at the C-terminus. |
Names |
Interleukin-7, IL-7, IL7 |
Accession # |
P13232 |
Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4 |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
Amino Acid Sequence |
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQ FLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCF LKRLLQEIKTCWNKILMGTKEHVDHHHHHH
|
Background |
Human Interleukin 7 (IL-7) is a potent lymphoid cell growth factor stimulating the proliferation of lymphoid progenitors. IL7 can associate with the hepatocyte growth factor (HGF) to form a hybrid cytokine that functions as a pre-pro-B cell growth-stimulating factor. Human IL7 cDNA encodes a 177 amino acid precursor protein containing a 25 amino acid signal peptide and a 152 amino acid mature protein. Human and mouse IL7 share 65% sequence identity in the mature region and both exhibit cross-species activity. IL-7 signals via IL-7 receptor (IL7R) activating multiple pathways including JaK/STAT and PI3K/AKT, which regulate lymphocyte survival, glucose uptake, proliferation, and differentiation. IL-7 is also associated with cytoplasmic IL2-R gamma for signal transduction. |