Catalog# |
C037 |
Source |
E.coli |
Description |
Recombinant Human Interleukin-8/IL-8 (3-79) produced in E. coli is a single non-glycosylated polypeptide chain containing 77 amino acids with a molecular mass of 8,904 Daltons. |
Names |
Interleukin-8, IL-8, C-X-C Motif Chemokine 8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, Monocyte-Derived Neutrophil Chemotactic Factor, MDNCF, Monocyte-Derived Neutrophil-Activating Peptide, MONAP, Neutrophil-Activating Protein 1, NAP-1, Protei |
Accession # |
P10145 |
Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Biological Activity |
Recombinant IL-8 (3-79) is fully biologically active when compared to standards.
ED50 is less than 2 ng/ml as determined by its chemotaxis of hCXCR-2 transfected mouse BaF/3 cells.
Specific Activity of 5.0 x 105 IU/mg. |
Purity |
Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE. |
Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
Amino Acid Sequence |
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQR VVEKFLKRAENS
|
Background |
Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states. |