| Catalog# |
C877 |
| Source |
HEK293 |
| Description |
Recombinant Human Integrin-Linked Kinase-Associated Serine/Threonine Phosphatase 2C/ILKAP is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-His392) of Human ILKAP fused with a polyhistidine tag at the C-terminus. |
| Names |
Integrin-Linked Kinase-Associated Serine/Threonine Phosphatase 2C, ILKAP |
| Accession # |
Q9H0C8 |
| Shipping |
The product is shipped at ambient temperature. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MDLFGDLPEPERSPRPAAGKEAQKGPLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATS ISQMVKTEGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILND ITEECRPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTF KHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEH NPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLAC DGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRI GHVDHHHHHH
|
| Background |
Integrin-Linked Kinase-Associated Serine/Threonine Phosphatase 2C (ILKAP) is a member of the protein serine/threonine phosphatase of the PP2C family. Protein phosphatase may play a role in regulation of cell cycle progression via dephosphorylation of its substrates. ILKAP is a cytoplasmic protein and contains one PP2C-like domain. ILKAP can interact with integrin-linked kinase (ILK/ILK1), a regulator of integrin mediated signaling, and regulate the kinase activity of ILK. Through the interaction with ILK, ILKAP may selectively affect the signaling process of ILK-mediated glycogen synthase kinase 3 beta (GSK3beta), and thus participate in the Wnt signaling pathway. |
