| Catalog# |
C234 |
| Source |
E.coli |
| Description |
Recombinant Human Inositol Monophosphatase 1/IMPA1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Asp277) of Human IMPA1 fused with a His tag at the N-terminus. |
| Names |
Inositol Monophosphatase 1, IMP 1, IMPase 1, Inositol-1(or 4)-Monophosphatase 1, Lithium-Sensitive Myo-Inositol Monophosphatase A1, IMPA1, IMPA |
| Accession # |
P29218 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.25 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTA TDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIG FAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMV LSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTG GPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
|
| Background |
Inositol Monophosphatase 1 (IMPA1) belongs to the inositol monophosphatase family. IMPA1 is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides, IMPA1 can use myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2-AMP as substrates. IMPA1 has been implicated as the pharmacological target for lithium action in brain. IMPA1 shows magnesium-dependent phosphatase activity and is inhibited by therapeutic concentrations of lithium. In addition, IMPA1 plays a improtant role in intracellular signal transduction. |
