| Catalog# |
C364 |
| Source |
HEK293 |
| Description |
Recombinant Human Kallikrein 7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu23-His252) of Human KLK7 fused with a polyhistidine tag at the C-terminus. |
| Names |
Kallikrein-7, hK7, Serine Protease 6, Stratum Corneum Chymotryptic Enzyme, hSCCE, KLK7, PRSS6, SCCE |
| Accession # |
P49862 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGD RRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTT TSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQG LVSWGTFPWGQPNDPGVYTQVCKFTKWINDTMKKHVDHHHHHH
|
| Background |
Human Kallikrein 7 is a member of the tissue kallikrein family of extracellular serine proteases that is made up of 15 members. It is predominantly expressed in the skin. A major physiological function of Kallikrein 7 is to regulate the desquamation process (the shedding of corneocytes from the outer layer of the epidermis) through proteolysis of the intercellular adhesive structures between corneocytes. Dysregulation of Kallikrein 7 has been linked to several inflammatory skin diseases including atopic dermatitis, psoriasis, and Netherton syndrome. Studies have shown that Kallikrein 5 is a potential physiological activator for Kallikrein 7. The proform of Kallikrein 7 can be activated by thermolysin. |