| Catalog# |
CC61 |
| Source |
HEK293 |
| Description |
Recombinant Human Ketohexokinase/KHK is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Val298) of Human KHK fused with a polyhistidine tag at the C-terminus. |
| Names |
Ketohexokinase, Hepatic fructokinase |
| Accession # |
P50053 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,50nM KCl,10%Glycerol,pH7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAP GHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDL TQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDV AKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTF NASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIVVDHHHHHH
|
| Background |
'Ketohexokinase, also known as Hepatic fructokinase, is a member of the carbohydrate kinase PfkB family. It exits as a homodimer and most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.This enzyme catalyzes conversion of fructose to fructose-1-phosphate. It is the first enzyme with a specialized pathway that catabolizes dietary fructose. Defects in KHK are the cause of fructosuria.' |
