| Catalog# |
CE62 |
| Source |
E.coli |
| Description |
Recombinant Human Karyopherin Subunit α-2/KPNA2 is produced by our E. coli expression system. The target protein is expressed with sequence (Ser2-Phe529) of Human KPNA2 fused with a 6His tag at the N-terminus. |
| Names |
Importin Subunit Alpha-2, Karyopherin Subunit Alpha-2, RAG Cohort Protein 1, SRP1-Alpha, KPNA2, RCH1, SRP1 |
| Accession # |
P52292 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDD QMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQP PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKVVVDGGAIPAFISLLASPH AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNK NPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGAS ELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTK IILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEE EEDQNVVPETTSEGYTFQVQDGAPGTFNF
|
| Background |
Karyopherin Subunit α-2 (KPNA2) belongs to the importin alpha family. KPNA2 is widely expressed in many tissues and contains an N-terminal hydrophilic region, a hydrophobic central region composed of 10 repeats, and a short hydrophilic C-terminus. KPNA2 interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination. KPNA2 functions in nuclear protein importantly as an adapter protein for nuclear receptor KPNB1. |
