| Catalog# |
C483 |
| Source |
HEK293 |
| Description |
Recombinant Human Lysosome-Associated Membrane Glycoprotein 2/LAMP2 produced by transfected human cells is a secreted protein with sequence (Leu29-Ile375) of Human LAMP2 fused with a polyhistidine tag at the C-terminus. |
| Names |
Lysosome-Associated Membrane Glycoprotein 2, LAMP-2, Lysosome-Associated Membrane Protein 2, CD107 Antigen-Like Family Member B, CD107b, LAMP2 |
| Accession # |
P13473 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFG PGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLST LEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTY SVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAV KNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQ PFNVTQGKYSTAQECSLDDDTIVDHHHHHH
|
| Background |
Lysosomal Associated Membrane Protein 2 (LAMP2) is a major component of lysosomal membranes. LAMP2 is a transmembrane glycoprotein about 110kDa. Mature human LAMP2 consists of a 347 amino acid (aa) intralumenal domain, a 24 aa transmembrane segment, and a 35 aa cytoplasmic tail . The lumenal domain is organized into two heavily N-glycosylated regions. Alternate splicing generates a human LAMP2 isoform (LAMP2B) with a substituted juxtamembrane lumenal region, cytoplasmic tail and transmenmbrane segment.LAMP2 itself can cleavage lysosomal luminal domain and degradation lysosomal. In the help of chaperone HSC73,LAMP2 mediates the lysosomal uptake in complex with cargo proteins and is required for the lysosomal destruction of autophagic vacuoles. |
