| Catalog# |
C574 |
| Source |
Human Cells |
| Description |
Recombinant Human CD300A is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Leu18-Gln178) of Human CD300A fused with a polyhistidine tag at the C-terminus. |
| Names |
CMRF35-Like Molecule 8, CLM-8, CD300 Antigen-Like Family Member A, CMRF-35-H9, CMRF35-H9, CMRF35-H, IRC1/IRC2, Immunoglobulin Superfamily Member 12, IgSF12, Inhibitory Receptor Protein 60, IRp60, NK Inhibitory Receptor, CD300a, CD300A, CMRF35H, IGSF12 |
| Accession # |
Q9UGN4 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
IN STOCK |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPA NLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTA FPPVSSTTLFAVGATHSASIQEETEEVVNSQVDHHHHHH
|
| Background |
CD300A is a single-pass type I membrane protein that belongs to the CD300 family. CD300A consists of a 163 amino acid (aa) extracellular domain (ECD) with one Ig-like V- type domain, a 21 amino acid transmembrane segment, and a 98 amino acid cytoplasmic domain with tyrosine residues. CD300A is expressed not only by natural killer (NK) cells but also by T-cell subsets, B-cells, dendritic cells, mast cells, granulocytes and monocytes. CD300A is an inhibitory receptor which may contribute to the down-regulation of cytolytic activity in natural killer (NK) cells, and to the down-regulation of mast cell degranulation. |
