| Catalog# |
C443 |
| Source |
HEK293 |
| Description |
Recombinant Human CD300C is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gly21-Arg183) of Human CD300C fused with a polyhistidine tag at the C-terminus. |
| Names |
CMRF35-Like Molecule 6, CLM-6, CD300 Antigen-Like Family Member C, CMRF35-A1, CMRF-35, Immunoglobulin Superfamily Member 16, IgSF16, CD300c, CD300C, CMRF35, CMRF35A, CMRF35A1, IGSF16 |
| Accession # |
Q08708 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIR DSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSG PPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRVDHHHHHH
|
| Background |
CD300C is a single-pass type I membrane protein which belongs to the immunoregulatory signaling (IRS) family. CD300C contains one Ig-like V-type domain and is present on the surface of natural killer cells, granulocytes, most myeloid cells, dendritic cells, and a subpopulation of T and B lymphocytes. The CD300C (CMRF-35A) and CD300A (CMRF-35H) molecules are homologous leukocyte surface proteins. CD300a and CD300C play an important role in the cross-regulation of TNF-alpha and IFN-alpha secretion from pDCs. CD300A and CD300C are indistinguishable on the surface of NK cells. The ligand for CD300C is presently unknown. |
