| Catalog# |
C201 |
| Source |
E.coli |
| Description |
Recombinant Human Low Molecular Weight Phosphotyrosine Protein Phosphatase/LMW-PTP is produced by our E. coli expression system. The target protein is expressed with sequence (Ala2-His158) of Human LMW-PTP. |
| Names |
Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Adipocyte Acid Phosphatase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, ACP1 |
| Accession # |
P24666 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLR NHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIED PYYGNDSDFETVYQQCVRCCRAFLEKAHLEHHHHHH
|
| Background |
Low Molecular Weight Phosphotyrosine Protein Phosphatase (LMW-PTP) is a member of the low molecular weight phosphotyrosine protein phosphatase family. LMW-PTP serves as an acid phosphatase and a protein tyrosine phosphatase (PTPase) by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. LMW-PTP can be detected in all human tissues, including adipocytes. LMW-PTP is a cytosolic enzyme that regulate cell proliferation and growth of leiomyomas during dephosphorylation of the PDGF receptor. In addition, LMW-PTP plays an important role in the regulation of physiological functions, such as stress resistance and synthesis of the polysaccharide capsule. |
