| Catalog# |
C486 |
| Source |
HEK293 |
| Description |
Recombinant Human Leucine-Rich Repeat-Containing Protein 4/LRRC4 produced by transfected human cells is a secreted protein with sequence (Ala39-Lys527) of Human LRRC4 fused with a polyhistidine tag at the C-terminus. |
| Names |
Leucine-Rich Repeat-Containing Protein 4, Brain Tumor-Associated Protein BAG, Nasopharyngeal Carcinoma-Associated Gene 14 Protein, Netrin-G2 Ligand, NGL-2, LRRC4, BAG |
| Accession # |
Q9HBW1 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
ASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEV LQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFN RVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEI RPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLH HNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLN ISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTN VAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTV LIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKVDHHHHHH
|
| Background |
Leucine-Rich Repeat-Containing Protein 4 (LRRC4) is a 55 kDa type I transmembrane protein. LRRC4 is a member of the NGL family of synaptic LRR adhesion molecules. Human LRRC4 cDNA encodes 653 amino acids (aa) that includes a signal sequence, extracellular domain (ECD), transmembrane domain, and cytoplasmic domain. The ECD contains nine LRRs, one C2 type Ig likedomain, and one Thr-rich segment. LRRC4 is predominantly expressed in the brain on neurons and astrocytes as a ligand for Netrin-G2 on the dendritic surface of synaptic neurons. LRRC4 is proposed to regulate the formation of excitatory synapses. The addition of soluble LRRC4 to cultured neurons can reduce excitatory synapse formation. |
