| Catalog# |
CA80 |
| Source |
Human Cells |
| Description |
Recombinant Human Leucine-Rich Repeat Neuronal Protein 1/LRRN1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser26-Ala631) of Human LRRN1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Leucine-Rich Repeat Neuronal Protein 1, Neuronal Leucine-Rich Repeat Protein 1, NLRR-1, LRRN1, KIAA1497 |
| Accession # |
Q6UXK5 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
SIQNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNLSSDTQVLLLQSNNIAKTVDE LQQLFNLTELDFSQNNFTNIKEVGLANLTQLTTLHLEENQITEMTDYCLQDLSNLQELYINHNQI STISAHAFAGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLANLRSL VLAGMYLTDIPGNALVGLDSLESLSFYDNKLVKVPQLALQKVPSLKFLDLNKNPIHKIQEGDFKN MLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALN AIYQKTVESLPNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLI QDSSEQCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSS EGTLEISNIQIEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSILVSWKV NSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCV NVTTKNAAFAVDISDQETSTALDHHHHHH
|
| Background |
Leucine-Rich Repeat Neuronal Protein 1 (LRRN1) is a member of the neuronal LRR family. Human LRRN1 is synthesized as a 683 amino acid protein that contains one CH (calponin-homology) domain and nine LRR (leucine-rich) repeats. LRRN1 is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. The calponin homology (CH) domain is suggested to confer actin binding to a variety of cytoskeletal and signaling molecules. Identified structural elements suggest that LRRN1 resembles a receptor. |
