| Catalog# |
C618 |
| Source |
HEK293 |
| Description |
Recombinant Human Leucine-Rich Repeat Transmembrane Neuronal Protein 2/LRRTM2 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Cys34-Arg422) of Human LRRTM2 fused with a polyhistidine tag at the C-terminus. |
| Names |
Leucine-Rich Repeat Transmembrane Neuronal Protein 2, Leucine-Rich Repeat Neuronal 2 Protein, LRRTM2, KIAA0416, LRRN2 |
| Accession # |
O43300 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
CPPKCRCEKLLFYCDSQGFHSVPNATDKGSLGLSLRHNHITELERDQFASFSQLTWLHLDHNQIS TVKEDAFQGLYKLKELILSSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLH LRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRL SSLHTLFLQWNKISNLTCGMEWTWGTLEKLDLTGNEIKAIDLTVFETMPNLKILLMDNNKLNSLD SKILNSLRSLTTVGLSGNLWECSARICALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQ LCWNLSTTVTVMATTYRDPTTEYTKRISSSSYHVGDKEIPTTAGIAVTTEEHFPEPDNAIFTQRV DHHHHHH
|
| Background |
Leucine-Rich Repeat Transmembrane Neuronal Protein 2 (LRRTM2) is a single-pass type I membrane protein that belongs to the LRRTM family. It contains ten LRR (leucine-rich) repeats, one LRRCT domain, and one LRRNT domain. LRRTM2 is expressed in neuronal tissues, and it interacts with DLG4 and NRXN1. LRRTM2 has been suggested to be involved in the development and maintenance of excitatory synapses in the vertebrate nervous system. LRRTM2 also regulates the surface expression of AMPA receptors. LRRTM2 acts as a ligand for the presynaptic receptors NRXN1-A and NRXN1-B. |
