| Catalog# |
C619 |
| Source |
HEK293 |
| Description |
Recombinant Human Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1/LYVE-1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu20-Thr238) of Human LYVE-1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1, LYVE-1, Cell Surface Retention Sequence-Binding Protein 1, CRSBP-1, Extracellular Link Domain-Containing Protein 1, Hyaluronic Acid Receptor, LYVE1, CRSBP1, HAR, XLKD1 |
| Accession # |
Q9Y5Y7 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-Citrate,1 50mM NaCl, pH 7.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFET CSYGWVGDGFVVISRISPNPKCGKNGVGVLIRKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDP IFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMST ETEPFVENKAAFKNEAAGFGGVPTVDHHHHHH
|
| Background |
Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1 is a single-pass type I membrane protein. LYVE-1 is a CD44 homolog found primarily on lymphatic endothelial cells 1. LYVE-1 mainly expressed in endothelial cells lining lymphatic vessels. While LYVE-1 functions is a Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. LYVE-1 plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). It may act as an hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes. |
