| Catalog# |
C982 |
| Source |
HEK293 |
| Description |
Recombinant Human Microfibrillar-Associated Protein 5/MFAP5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ile22-Leu173) of Human MFAP5 fused with a 6His tag at the C-terminus. |
| Names |
Microfibrillar-Associated Protein 5, MFAP-5, MP25, Microfibril-Associated Glycoprotein 2, MAGP-2, MFAP5, MAGP2 |
| Accession # |
Q13361 |
| Shipping |
The product is shipped at ambient temperature. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWD EKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRL RRSNYFRLPPCENVDLQRPNGLVDHHHHHH
|
