| Catalog# |
CI17 |
| Source |
HEK293 |
| Description |
Recombinant Human Mesencephalic astrocyte-derived neurotrophic factor/MANF is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Leu25-Leu182) of Human MANF fused with a polyhistidine tag at the C-termin_x0007__x0000__x001F_ |
| Names |
Mesencephalic astrocyte-derived neurotrophic factor,Arginine-rich protein,Protein ARMET,ARMET, ARP |
| Accession # |
P55145 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
LRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKII NEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGC AEKSDYIRKINELMPKYAPKAASARTDLVDHHHHHH
|
| Background |
MANF also called ARMET or ARP, is short for Mesencephalic astrocyte- derived neurotrophic factor. It is a 182 aa. protein with a 24 aa. signal peptide. The N-terminal region of MANF may be responsible for neurotrophic activity while the C-terminal region may play a role in the ER stress response. It is secreted and can be inducted by endoplasmic reticulum stress. This protein selectively promotes the survival of dopaminergic neurons of the ventral mid-brain, and can modulates GABAergic transmission to the dopaminergic neurons of the substantia nigra. It also enhances spontaneous, as well as evoked, GABAergic inhibitory postsynaptic currents in dopaminergic neurons and inhibits cell proliferation and endoplasmic reticulum (ER) stress-induced cell death. |
