| Catalog# |
CE88 |
| Source |
E.coli |
| Description |
Recombinant Human Microtubule-Associated Proteins 1A/1B Light Chain 3A/MAP1LC3A is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Phe121) of Human MAP1LC3A fused with a 6His tag at the C-terminus. |
| Names |
Microtubule-Associated Proteins 1A/1B Light Chain 3A, Autophagy-Related Protein LC3 A, Autophagy-Related Ubiquitin-Like Modifier LC3 A, MAP1 Light Chain 3-Like Protein 1, MAP1A/MAP1B Light Chain 3 A, MAP1A/MAP1B LC3 A, Microtubule-Associated Protein 1 Lig |
| Accession # |
Q9H492 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris, 20% Glycerol, 0.1M NaCl, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVK IIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH
|
| Background |
Microtubule-Associated Proteins 1A/1B Light Chain 3A (MAP1LC3A) belongs to the MAP1 LC3 family. MAP1LC3A is found most abundantly in the heart, brain, liver, skeletal muscle, and testis. But it is absent in the thymus and peripheral blood leukocytes. MAP1LC3A is thought to take part in the formation of autophagosomal vacuoles and is one of the light chain subunits that functions together with both MAP1A and/or MAP1B. In addition, MAP1A has an important part in neuronal development and in maintaining the balance between neuronal plasticity and rigidity. |