Catalog# |
C051 |
Source |
E.coli |
Description |
Recombinant Human Myelin Oligodendrocyte Glycoprotein/MOG is produced with our E. coli expression system. The target protein is expressed with sequence (Gly30-Gly154) of Human MOG protein. |
Names |
Myelin-Oligodendrocyte Glycoprotein, MOG |
Accession # |
Q16653 |
Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5 |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Biological Activity |
Tested for capability to induce EAE in rodents and monkeys |
Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
Amino Acid Sequence |
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPE YRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHH HH
|
Background |
Myelin Oligodendrocyte Glycoprotein (MOG) is a transmembrane protein, which is expressed exclusively in the CNS. MOG contains a single Ig-domain exposed to the extracellular space that allows autoantibodies easy access. MOG protein has been identified as a crucial autoantigen for multiple sclerosis in humans. MOG is capable to produce a demyelinating multiple sclerosis-like diseases in experimental animals, namely experimental autoimmune encephalomyelitis (EAE), in rodents and monkeys. |