| Catalog# |
CE21 |
| Source |
E.coli |
| Description |
Recombinant Human Mitogen-Activated Protein Kinase Scaffold Protein 1/MAPKSP1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Val124) of Human LAMTOR3 fused with a 6His tag at the N-terminus. |
| Names |
Ragulator Complex Protein LAMTOR3, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 3, MEK-Binding Partner 1, Mp1, Mitogen-Activated Protein Kinase Kinase 1-Interacting Protein 1, Mitogen-Activated Protein Kinase Scaffold Protein 1, LAMTOR3, M |
| Accession # |
Q9UHA4 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, 5mM DTT, 30% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHAL RPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKEL APLFEELRQVVEVS
|
| Background |
Mitogen-Activated Protein Kinase Scaffold Protein 1 (MAPKSP1) was identified as an interacting protein that belongs to the LAMTOR3 family. MAPKSP1 restricted to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. MAPKSP1 interacts with MAP2K1/MEK1 and MAPK2 and enhances the activation of MAPK2, and thus is thought to function as an adaptor to enhance the efficiency of the MAP kinase cascade. |
