| Catalog# |
C270 |
| Source |
E.coli |
| Description |
Recombinant Human NAD Kinase/NADK is produced by our E. coli expression system. The target protein is expressed with sequence (Ser64-Gly446) of Human NADK fused with a 6His tag at the N-terminus. |
| Names |
NAD Kinase, Poly(P)/ATP NAD Kinase, NADK |
| Accession # |
O95544 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 50mM Tris-HCl, 150mM NaCl, 1mM DTT, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSV LVIKKMRDASLLQPFKELCTHLMEENMIVYVEKKVLEDPAIASDESFGAVKKKFCTFREDYDDIS NQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLR SRLKVRVVKELRGKKTAVHNGLGEKGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVY LDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELK IMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLHWNVRKK QAHFEEEEEEEEEG*
|
| Background |
NAD Kinase (NADK) is an enzyme that belongs to the NAD Kinase family. It is a widely expressed enzyme, but it is not detected in skeletal muscle. NADK converts Nicotinamide Adenine Dinucleotide (NAD+) into NADP+, through phosphorylating the NAD+ coenzyme. NADP+ is an essential coenzyme in metabolism and provides reducing power to biosynthetic processes such as fatty acid biosynthesis. The structure of the NADK from the archaean Archaeoglobus fulgidus has been determined. |
