| Catalog# |
C172 |
| Source |
E.coli |
| Description |
Recombinant Human Sentrin-Specific Protease 8/SENP8 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Lys212) of Human SENP8. |
| Names |
Sentrin-Specific Protease 8, Deneddylase-1, NEDD8-Specific Protease 1, Protease Cysteine 2, Sentrin/SUMO-Specific Protease SENP8, SENP8, DEN1, NEDP1, PRSC2 |
| Accession # |
Q96LD8 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFH DCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQ DKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALC QNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
|
| Background |
Sentrin-Specific Protease 8 (SENP8) mediates the reversible covalent modification of proteins by NEDD8. SENP8 catalyzes the full-length NEDD8 to generate its mature form and deconjugation of NEDD8 from targeted proteins such as CUL2 , CUL4A in vivo, or p53. but it does not show activity against ubiquitin or SUMO proteins. |
