| Catalog# |
C494 |
| Source |
HEK293 |
| Description |
Recombinant Human Neuroplastin is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gln29-His220) of Human NPTN fused with a polyhistidine tag at the C-terminus. |
| Names |
Neuroplastin, Stromal Cell-Derived Receptor 1, SDR-1, NPTN, SDFR1, SDR1 |
| Accession # |
Q9Y639 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
QNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPR AEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKK ENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHVDH HHHHH
|
| Background |
Neuroplastin is a 52-57 kDa member of the Ig-superfamily. Neuroplastin likely serves as a cell adhesion molecule, and is widely expressed in multiple tissues. Human Neuroplastin is 282 amino acids in length. Human Neuroplastin is a type I transmembrane glycoprotein that contions two Ig-like domains (aa 32-119 and 122-213) and a 38 aa cytoplasmic region (aa 245-282). |
