| Catalog# |
CB27 |
| Source |
HEK293 |
| Description |
Recombinant Human Neurotrimin is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly34-Leu316) of Human Neurotrimin fused with a polyhistidine tag at the C-terminus. |
| Names |
Neurotrimin (NTM), also known as IgLON family member 2, IGLON2, HNT and NTRI, is a member of the immunoglobulin superfamily and IgLON family. |
| Accession # |
Q9P121-3 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQY SIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRP EPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEA KGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNY TCVASNKLGHTNASIMLFGETVLVDHHHHHH
|
| Background |
Neurotrimin localizes to the cell membrane and contains three Ig-like C2-type (immunoglobulin-like) domains. Neurotrimin acts as a glycosylphosphatidylinositol (GPI)-anchored neural cell adhesion molecule. Neurotrimin may promote neurite outgrowth and adhesion via homophilic and heterophilic interactions. |
