| Catalog# |
C060 |
| Source |
E.coli |
| Description |
Recombinant Human NGF Beta (β-Nerve Growth Factor/β-NGF) produced in E. coli is a non-glycosylated non-covalent homodimer of two 118 amino acid polypeptides each with a molecular mass of 13.4 kD. |
| Names |
Recombinant Human NGF Beta, Beta-Nerve Growth Factor, Beta-NGF, NGF, NGFB |
| Accession # |
P01138 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
ED50 is less than 1.0 ng/ml as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells.
Specific Activity is greater than 1 x 106 IU/mg. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVD SGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
|
| Background |
Recombinant Human NGF Beta: β-Nerve Growth Factor/β-NGF was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits α, β, and γ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. Β-NGF is a neurotrophic factor that signals through its receptor β-NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. Β-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that β-NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Recombinant Human NGF Beta shares 90% sequence similarity with mouse protein and shows cross-species reactivity. |
| References |
Forsell P,et al.The Use of TrkA-PathHunter Assay in High-Throughput Screening to Identify Compounds That Affect Nerve Growth Factor Signaling
PMID:23458757
http://www.ncbi.nlm.nih.gov/pubmed/23458757 |
