| Catalog# |
CE48 |
| Source |
E.coli |
| Description |
Recombinant Human 60S Ribosome Subunit Biogenesis Protein NIP7 Homolog/NIP7 produced by E. coli expression system. The target protein is expressed with sequence (Met1-Thr180) of Human NIP7 fused with a 6His tag at the N-terminus. |
| Names |
60S Ribosome Subunit Biogenesis Protein NIP7 Homolog, KD93, NIP7 |
| Accession # |
Q9Y221 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVY YVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYG NHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRH EETLT
|
| Background |
60S Ribosome Subunit Biogenesis Protein NIP7 Homolog (NIP7) belongs to the NIP7 family. NIP7 contains one PUA domain, it is essential for the process of proper 27S pre-rRNA and 60S ribosome subunit assembly. NIP7 is a monomer form and interacts with NOL8 and SBDS, and may bind to RNA. In addition, NIP7 is one of the many trans-acting factors required for eukaryotic ribosome biogenesis, which interacts with nascent pre-ribosomal particles and dissociates as they complete maturation and are exported to the cytoplasm. |
