| Catalog# |
C080 |
| Source |
E.coli |
| Description |
Recombinant Human precursor form of Neurotrophin-3/pro-NT3 is produced by our E. coli expression system. |
| Names |
Neurotrophin-3, NT-3, HDNF, Nerve Growth Factor 2, NGF-2, Neurotrophic Factor, NTF3 |
| Accession # |
P20783 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAF QPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYAEHKSHRG EYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKH WNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT
|
| Background |
Pro-Neurotrophin-3 (pro-NT3) is the precursor form of Neurotrophin-3. Pro-NT3 interacts preferentially with the pan-neurotrophin receptor p75 (p75NTR) and vps10p domain-containing receptor sortilin and induces neuronal apoptosis, whereas mature NT3 selectively binds with high affinity to the TrkB kinase receptor and promotes the survival, growth and differentiation of neurons. As proneurotrophins and mature neurotrophins elicit opposite biological effects, Pro-BDNF cleavage in the neuronal system is regulated in a specific and cell-context dependent manner. |
| References |
Howard L,et al.ProNGF promotes neurite growth from a subset of NGF-dependent neurons by a p75NTR-dependent mechanism
PMID:23633509
http://www.ncbi.nlm.nih.gov/pubmed/23633509 |
