| Catalog# |
CA38 |
| Source |
Human Cells |
| Description |
Recombinant Human Linker for Activation of T-Cells Family Member 2/LAT2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg27-Ala243) of Human LAT2 fused with a 6His tag at the C-terminus. |
| Names |
Linker for Activation of T-Cells Family Member 2, Linker for Activation of B-Cells, Membrane-Associated Adapter Molecule, Non-T-Cell Activation Linker, Williams-Beuren Syndrome Chromosomal Region 15 Protein, Williams-Beuren Syndrome Chromosomal Region 5 Protein, LAT2, LAB, NTAL, WBS15, WBSCR15, WBSCR5 |
| Accession # |
Q9GZY6 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
RCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLADMAPTRKDKLLQFYPSLEDPA SSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGI GGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMGQLQREASPGPV GSPDEEDGEPDYVNGEVAATEAVDHHHHHH
|
| Background |
Linker for Activation of T-Cells Family Member 2 (LAT2) is a single-pass type III membrane protein. LAT2 is highly expressed in the spleen, peripheral blood lymphocytes, and germinal centers of lymph nodes. LAT2 is involved in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. It may also be involved in BCR (B-cell antigen receptor)-mediated signaling in B-cells and FCGR1 (high affinity immunoglobulin gamma Fc receptor I)-mediated signaling in myeloid cells. Coupleing activate of these receptors and their associated kinases with distal intracellular events through the recruitment of GRB2. |