| Catalog# |
C497 |
| Source |
HEK293 |
| Description |
Recombinant Human Transmembrane Glycoprotein NMB/GPNMB produced by transfected human cells is a secreted protein with sequence (Ala22-Pro486) of Human GPNMB fused with a polyhistidine tag at the C-terminus. |
| Names |
Transmembrane Glycoprotein NMB, Transmembrane Glycoprotein HGFIN, GPNMB, HGFIN, NMB |
| Accession # |
Q14956 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
AKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDS PALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQS HHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVYRRH GRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTINY KWSFGDNTGLFVSTNHTVNHTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSY DSNTPGPAGDNPLELSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLID FVVTCQGSIPTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSL ALTSTLISVPVDHHHHHH
|
| Background |
Osteoactivin is an intracellular glycoprotein belongs to the NMB/pMEL-17 family, which is asscociated with cell endosomal/lysomal compartments. Human Osteoactivin is a 560 amino acid type I transmembrane protein, and one alternate splice form shows a 12 amino acid insert between amino acid 339-340. An additional 206 amino acid isoform shows a mutation at position 181 that results in a 26 amino acid substitution for the C-terminal 380 amino acids. Cells knowns to express Osteoactivin include fibroblast, osteoblasts, myeloid dendritic cell, melanocytes, plus fetal chondrocytes and stratum basale keratinocytes, macrophages/keratinocytes. |
