| Catalog# |
CE72 |
| Source |
E.coli |
| Description |
Recombinant Human Cyclin-Dependent Kinase Inhibitor 1/CDKN1A is produced by our E. coli expression system. The target protein is expressed with sequence (Ser2-Pro164) of Human CDKN1A fused with a 6His tag at the C-terminus. |
| Names |
Cyclin-Dependent Kinase Inhibitor 1, CDK-Interacting Protein 1, Melanoma Differentiation-Associated Protein 6, MDA-6, p21, CDKN1A, CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1 |
| Accession # |
P38936 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLRRDCDALMAGCIQEARERWNFDFVTETPLEGDFAW ERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGS PGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKPLEHHHHHH
|
| Background |
Cyclin-Dependent Kinase Inhibitor 1 (CDKN1A) is a member of the CDI family. CDKN1A is widely expressed in all adult tissues, but low expressed in the brain tissue. CDKN1A can be induced by p53/TP53, mezerein and IFNB1, repressed by HDAC1. CDKN1A may be an important intermediate, by which p53/TP53 mediates its role as an inhibitor of cellular proliferation in response to DNA damage, CDKN1A can bind to and inhibit cyclin-dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression. |
