| Catalog# |
CG44 |
| Source |
E.coli |
| Description |
Recombinant Human Parvulin-14/PIN4 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Lys156) of Human PIN4 fused with a 6His tag at the N-terminus. |
| Names |
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4, Parvulin-14, Parvulin-17, Peptidyl-prolyl cis-trans isomerase Pin4, Peptidyl-prolyl cis/trans isomerase EPVH, Rotamase Pin4, PIN4, |
| Accession # |
Q9Y237-2 |
| Formulation |
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASG SDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWM TRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
|
| Background |
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4(PIN4) is a peptidyl-prolyl cis/trans isomerase (PPIase) which interacts with NIMA and is vital for cell cycle regulation. PIN4 has 2 different isoforms: PAR14 and PAR17. Furthermore, PIN4 protein binds to double-stranded DNA under physiological salt conditions. PIN4 is involved as a ribosomal RNA processing factor in ribosome biogenesis. The PAR14 binds to tightly bent AT-rich stretches of double-stranded DNA, but PAR17 binds to double-stranded DNA. |
