| Catalog# |
CE03 |
| Source |
E.coli |
| Description |
Recombinant Human Phenazine Biosynthesis-Like Domain-Containing Protein/PBLD is produced by our E.coli expression system. The target protein is expressed with sequence (Met1-Ala288) of Human PBLD fused with a 6His tag at the N-terminus. |
| Names |
Phenazine Biosynthesis-Like Domain-Containing Protein, MAWD-Binding Protein, MAWDBP, Unknown Protein 32 From 2D-PAGE of Liver Tissue, PBLD, MAWBP |
| Accession # |
P30039 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, 1mM DTT, 30% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLS ETAFIRKLHPTDNFAQSSCFGLRWFTPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGEL RARRAEDGIVLDLPLYPAHPQDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLE NLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQAFDFYSRYFAPWVGVAEDPVTGSAHAVLSSY WSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAVVLEGTLTA
|
| Background |
Phenazine Biosynthesis-Like Domain-Containing protein (PBLD) belongs to the phenazine biosynthesis-like protein (PhzF) family, which is expressed in most tissues. PBLD takes part in the MAPK signaling pathway, and is involved in multiple basic cellular functions. The expression of PBLD can be increased in several disease processes, including insulin resistance, folate deficiency and hypotension. |
