| Catalog# |
C298 |
| Source |
E.coli |
| Description |
Recombinant Human PDGF-Associated Protein/PAP is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Lys181) of Human PDAP1 fused with a 6His tag at the N-terminus. |
| Names |
28 kDa Heat- and Acid-Stable Phosphoprotein, PDGF-Associated Protein, PAP, PDGFA-Associated Protein 1, PAP1, PDAP1, HASPP28 |
| Accession # |
Q13442 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, 0.1mM PMSF, 2mM DTT, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGD GAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRR EREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQ SLSLNK
|
| Background |
Human PAP, also known as 28 kDa heat- and acid-stable phosphoprotein, PDGF-associated protein, PDGFA-associated protein 1, PDAP1, HASPP28, is a protein which belongs to the PDAP1 family. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. PDGF-Associated Protein (PAP) is a phosphoprotein that may enhance PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB. PDAP1 expression is induced by TNF-alpha, and cells overexpressing PDAP1 show significantly less apoptosis on exposure to TNF-alpha. |
