| Catalog# |
C510 |
| Source |
Human Cells |
| Description |
Recombinant Human Serum Amyloid P-Component/SAP produced by transfected human cells is a secreted protein with sequence (His20-Val223) of human APCS fused with a polyhistidine tag at the C-terminus. |
| Names |
Serum Amyloid P-Component, SAP, 9.5S Alpha-1-Glycoprotein, APCS, PTX2 |
| Accession # |
P02743 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
HTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYK ERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQGYFVEAQPK IVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGY VIIKPLVWVDHHHHHH
|
| Background |
Serum Amyoid P Component (SAP) is a monomeric 25 kDa secreted serum glycoprotein that belongs to the pentraxins family. The members of pentaxin superfamily be characterised by calcium dependent ligand binding and distinctive flattened β-jellyroll structure similar to that of the legume lectins. SAP is a non-fibrillar component, it can interact with DNA and histones. It regulates the solubility of amyloid fibrils and protects them from degradation by proteolytic enzymes and phagocytic cells. SAP scavenge nuclear material released from damaged circulating cells. It has been proposed that SAP may function as an opsonin for a variety of ligands including autoantigens, apoptotic cells, chromatin and micro-organisms. |
