| Catalog# |
C287 |
| Source |
E.coli |
| Description |
Recombinant Human PIN2/TERF1-Interacting Telomerase Inhibitor 1/PINX1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Lys328) of Human PINX1 fused with a 6His tag at the N-terminus. |
| Names |
PIN2/TERF1-Interacting Telomerase Inhibitor 1, Liver-Related Putative Tumor Suppressor, Pin2-Interacting Protein X1, Protein 67-11-3, TRF1-Interacting Protein 1, PINX1, LPTL, LPTS |
| Accession # |
Q96BK5 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 1mM DTT, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGL GAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKS FSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSA FTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKINKEATGKDVESYLQPKAKRHTEGKP ERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKP VEIAEDATLEETLVKKKKKKDSK
|
| Background |
PIN2/TERF1-Interacting Telomerase Inhibitor 1 (PINX1) belongs to the PINX1 family . PINX1 contains a G-patch domain and a Telomerase Inhibiting Domain that is capable of binding MCRS1, TERT and TERF1. PINX1 is a widely expressed protein that localizes to nucleoli and telomere speckles. PINX1 can mediate TRF1 and TERT accumulation in nucleolus and enhance TRF1 binding to telomeres. PINX1 is recruited to chromosome periphery by Nucleolin, the complex is necessary for faithful chromosome congression. In addition, PINX1 may inhibit cell proliferation and act as tumor suppressor. |
