| Catalog# |
CE10 |
| Source |
E.coli |
| Description |
Recombinant Human Phosphatidylinositol Transfer Protein α Isoform/PITPNA produced by our E. coli expression system. The target protein is expressed with sequence (Val2-Asp270) of Human PITPNA fused with a 6His tag at the N-terminus. |
| Names |
Phosphatidylinositol Transfer Protein Alpha Isoform, PI-TP-Alpha, PtdIns Transfer Protein Alpha, PtdInsTP Alpha, PITPNA, PITPN |
| Accession # |
Q00169 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 1mM EDTA, 1mM DTT, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVN EPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIK IETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGP NWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTM DDIRRMEEETKRQLDEMRQKDPVKGMTADD
|
| Background |
Phosphatidylinositol Transfer Protein α Isoform (PITPNA) is found in the cytoplasm and belongs to the PtdIns transfer protein family. PITPNA is a ubiquitous and highly conserved protein in multicellular eukaryotes that catalyzes the exchange of phospholipids between membranes and participates in cellular phospholipid metabolism, signal transduction and vesicular trafficking in vivo. It is expressed in a wide range of tissues and implicated in phospholipase C signaling and in the production of phosphatidylinositol 3, 4, 5-trisphosphate (PIP3) by phosphoinositide-3-kinase. |
