| Catalog# |
C247 |
| Source |
E.coli |
| Description |
Recombinant Human cAMP-dependent Protein Kinase Inhibitor β/PKI-β is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Lys78) of Human PKI-β fused with a His tag at the N-terminus. |
| Names |
cAMP-Dependent Protein Kinase Inhibitor Beta, PKI-beta, PKIB, PRKACN2 |
| Accession # |
Q9C010 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 20% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDL PLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK
|
| Background |
cAMP-Dependent Protein Kinase Inhibitor β (PKI-β) is a member of the PKI family. It has been shown that PKI-β is an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity; this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains. |
