| Catalog# |
C252 |
| Source |
E.coli |
| Description |
Recombinant Human Phosphopantothenoylcysteine Decarboxylase/PPC-DC is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Ser204) of Human PPCDC fused with a His tag at the N-terminus. |
| Names |
Phosphopantothenoylcysteine Decarboxylase, PPC-DC, PPCDC, COAC |
| Accession # |
Q96CD2 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 50mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPG LEVAVVTTERAKHFYSPQDIPVTLYSDADEWEMWKSRSDPVLHIDLRRWADLLLVAPLDANTLGK VASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGD EGLGAMAEVGTIVDKVKEVLFQHSGFQQS
|
| Background |
Phosphopantothenoylcysteine Decarboxylase (PPC-DC) is an essential enzyme in the biosynthesis of Coenzyme A and catalyzes the decarboxylation of PPC to Phosphopantetheine. PPC-DC catalyzes the decarboxylation of the Cysteine moiety of 4-Phosphopantothenoylcysteine (PPC) to form 4-Phosphopantetheine (PPantSH), this reaction forms part of the biosynthesis of Coenzyme A. The enzyme is a member of the larger family of Cysteine Decarboxylases including the Lantibiotic-Biosynthesizing enzymes EpiD and MrsD, all of which use a tightly bound Flavin cofactor to oxidize the Thiol moiety of the substrate to a Thioaldehyde. |
