| Catalog# |
CI44 |
| Source |
HEK293 |
| Description |
Recombinant Human MLN is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Phe26-Lys115) of Human MLN fused with a polyhistidine tag at the C-terminus. |
| Names |
Promotilin, Motilin-associated peptide, MLN |
| Accession # |
P12872 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMN SRQLEKYPATLEGLLSEMLPQHAAKVDHHHHHH
|
| Background |
Promotilin is a 115 amino acids protein that belongs to the motilin family. It is a secreted protein that plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle. |
