| Catalog# |
C255 |
| Source |
E.coli |
| Description |
Recombinant Human Protein CutA/CUTA is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Pro156) of Human CUTA fused with a His tag at the C-terminus. |
| Names |
Protein CutA, Acetylcholinesterase-Associated Protein, Brain Acetylcholinesterase Putative Membrane Anchor, CUTA, ACHAP, C6orf82 |
| Accession # |
O60888 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 1mM DTT, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAV VEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPV EQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
|
| Background |
Protein CutA (CUTA) posseses a signal peptide and is widely expressed in brain. CUTA may forms part of a complex of membrane proteins attached to acetylcholinesterase (AChE). CUTA takes part in cellular tolerance to a broad range of divalent cations other than copper. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found. |
