| Catalog# |
CG06 |
| Source |
E.coli |
| Description |
Recombinant Human Tyrosine-Protein Phosphatase Non-Receptor Type 1/PTPN1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Thr435) of Human PTPN1 fused with a His tag at the N-terminus. |
| Names |
Tyrosine-Protein Phosphatase Non-Receptor Type 1, Protein-Tyrosine Phosphatase 1B, PTP-1B, PTPN1, PTP1B |
| Accession # |
P18031 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 25mM Tris, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MNHKVHHHHHHMEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDH SRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSL KCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGV PESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKV LLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPK RILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSL RGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNTVDLQSR
|
| Background |
Tyrosine-Protein Phosphatase Non-Receptor Type 1 (PTPN1) is an enzyme containing 1 tyrosine-protein phosphatase domain. PTPN1 belongs to the protein tyrosine phosphatase (PTP) family, member of which catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. PTPs were isolated and identified based on their enzymatic activity and amino acid sequence. PTPN1 can dephosphorylate the phosphotyrosine residues of the activated insulin receptor kinase. It acts as a regulator of endoplasmic reticulum unfolded protein response and regulates the EFNA5-EPHA3 signaling pathway. PTPN1 is implicated in the regulation of cell growth, differentiation, cell responses to cytokines and hormones, and malignancy transformation. |
