| Catalog# |
C168 |
| Source |
E.coli |
| Description |
Recombinant Human Protein-Tyrosine Phosphatase 1C/PTP1C is produced with our E. coli expression system. The target protein is expressed with sequence (Lys243-Ile541) of Human PTP1C |
| Names |
Tyrosine-Protein Phosphatase Non-Receptor Type 6, Hematopoietic Cell Protein-Tyrosine Phosphatase, Protein-Tyrosine Phosphatase 1C, PTP-1C, Protein-Tyrosine Phosphatase SHP-1, SH-PTP1, PTPN6, HCP, PTP1C |
| Accession # |
P29350 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 25mM Tris-HCl, 2mM β-ME, 1mM EDTA, 1mM DTT, 20% Glycerol, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSDYINA NYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNKCVPYWPEVG MQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLD QINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMV QTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNILEHHHHHH
|
| Background |
Protein-Tyrosine Phosphatase 1C (PTP1C) belongs to the protein-tyrosine phosphatase family.which is known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTP1C is highly expressed in leukocyte cell type. It contains two SH2 domains and one tyrosine-protein phosphatase domain. The SH2 regions may interact with other cellular components to modulate its own phosphatase activity against interacting substrates. In addition, PTP1C also modulates signaling by tyrosine phosphorylated cell surface receptors. |
