| Catalog# |
CA30 |
| Source |
HEK293 |
| Description |
Recombinant Human Ribonuclease Pancreatic/RNASE1 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Lys29-Thr156) of Human RNASE1 fused with a 6His tag at the C-terminus. |
| Names |
Ribonuclease Pancreatic, HP-Rnase, RIB-1, RNase UpI-1, Ribonuclease 1, RNase 1, Ribonuclease A, RNase A, RNASE1, RIB1, RNS1 |
| Accession # |
P07998 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
KESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTC KNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTVD HHHHHH
|
| Background |
Ribonuclease Pancreatic is a secreted enzyme that belongs to the pancreatic ribonuclease family. RNASE1 is an endonuclease that cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. RNASE1 prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. RNASE1 acts on single stranded and double stranded RNA. |
