| Catalog# |
CA50 |
| Source |
HEK293 |
| Description |
Recombinant Human Ribonuclease K6/RNASE6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Trp24-Leu150) of Human RNASE6 fused with a polyhistidine tag at the C-terminus. |
| Names |
Ribonuclease K6, RNase K6, RNASE6, RNS6 |
| Accession # |
Q93091 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mMDTT,10%Glycerol,pH7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNR RHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSILVDH HHHHH
|
| Background |
Ribonuclease K6 (RNASE6) is a secreted protein that belongs to the pancreatic ribonuclease family. Human RNASE6 is synthesized as a 150 amino acid precursor that contains a 23 amino acid signal sequence, and a 127 amino acid mature chain. RNASE6 is expressed in many tissues, with high expression levels in the lung, with lower expression levels in the heart, placenta, kidney, pancreas, liver, brain, and skeletal muscle. It is also detected in monocytes and neutrophils. RNASE6 may have a role in host defense. |
