| Catalog# |
CC82 |
| Source |
HEK293 |
| Description |
Recombinant Human Secretogranin-2/SCG2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser29-Met617) of Human SCG2 fused with a polyhistidine tag at the C-terminus. |
| Names |
Secretogranin-2 is also known as Chromogranin-C,Secretogranin II, SgII. |
| Accession # |
P13521 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
SFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIENLRQQAHKEESSPDYNPYQGVSVPLQQKEN GDESHLPERDSLSEEDWMRIILEALRQAENEPQSAPKENKPYALNSEKNFPMDMSDDYETQQWPE RKLKHMQFPPMYEENSRDNPFKRTNEIVEEQYTPQSLATLESVFQELGKLTGPNNQKRERMDEEQ KLYTDDEDDIYKANNIAYEDVVGGEDWNPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQL GIQEEGLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQLIE ISRNLQIPPEDLIEMLKTGEKPNGSVEPERELDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKT PGGAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAW IPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEGDLQEEEQIEQAIK EHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRA MENMVDHHHHHH
|
| Background |
Secretogranin-2 is also known as Chromogranin-C,Secretogranin II, SgII. In humans, it is encoded by the SCG2 gene.It belongs to the chromogranin/secretogranin protein family. Secretogranin-2 is a neuroendocrine secretory granule protein, which is the precursor for biologically active peptides. It derived secretoneurin was distributed with strong immunoreactivity in the somata of pelvic ganglion neurons,72% of which also contained tyrosine hydroxyldse,as well as in nerve terminals in the muscular layer and the lamina propria of the vas deferens. |
