| Catalog# |
CD48 |
| Source |
Human Cells |
| Description |
Recombinant Human Sclerostin is produced by our mammalian expression system. The target protein is expressed with sequence (Gln24-Tyr213) of Human SOST with a polyhistidine tag at the C-terminus. |
| Names |
SOST, UNQ2976, PRO7455, PRO7476 |
| Accession # |
Q9BQB4 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris, 250mM NaCl, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRY VTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEA PRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAYHHHHH H
|
| Background |
Sclerostin, also known as SOST, is a member of the Cerberus/DAN family of BMP antagonists. SOST is asecreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain. It shows sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. SOST is produced by the osteocyte and has anti-anabolic effects on bone formation. It is a negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. |
