| Catalog# |
C674 |
| Source |
Human Cells |
| Description |
Recombinant Human Secretagogin/SCGN is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Pro276) of Human SCGN fused with a polyhistidine tag at the C-terminus. |
| Names |
Secretagogin, SCGN, SECRET |
| Accession # |
O76038 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQ FMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAEL RNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACST EERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGK IQKSELALCLGLKINPVDHHHHHH
|
| Background |
Secretagogin (SCGN) is a secreted calcium-binding protein that is found in the cytoplasm; a small proportion is associated with secretory granules and membrane fractions. SCGN contains six EF-hand domains, related to calbindin D-28K and calretinin. SCGN is thought to be involved in KCL-stimulated calcium flux and cell proliferation SCGN can be detected in human serum after ischemic neuronal damage. SCGN may function to negatively control growth and differentiation rates and, thus, indirectly inhibit cell replication. |
