| Catalog# |
C499 |
| Source |
Human Cells |
| Description |
Recombinant Human Semaphorin-5A/SEMA5A produced by transfected human cells is a secreted protein with sequence (Glu23-Thr765) of Human SEMA5A fused with a polyhistidine tag at the C-terminus. |
| Names |
Semaphorin-5A, Semaphorin-F, Sema F, SEMA5A, SEMAF |
| Accession # |
Q13591 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 0.1mM EDTA, 0.05% Tween 20, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
IN STOCK |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
EAQGTTQCQRTEHPVISYKEIGPWLREFRAKNAVDFSQLTFDPGQKELVVGARNYLFRLQLEDLS LIQAVEWECDEATKKACYSKGKSKEECQNYIRVLLVGGDRLFTCGTNAFTPVCTNRSLSNLTEIH DQISGMARCPYSPQHNSTALLTAGGELYAATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEP NFVSSYDIGNFTYFFFRENAVEHDCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPG EVPFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLP YPNPNPHFQCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQG REALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLRE HVVKIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVDGH FGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTPWTSWSPC STTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWGPWERCTAQCGGG IQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARL ADPNLLEVGRQRIEMRYCSSDGTSGCSTLDHHHHHH
|
| Background |
Semaphorin-5A (SEMA5A) is a member of the Semaphorin family of axon guidance molecules. SEMA5A is a 140 kDa protein. Class 5 Semaphorins are type I transmembrane glycoproteins with an N- terminal Sema domain and multiple juxtamembrane type 1 Thrombospondin (TSP) repeats within their extracellular domains. SEMA5A is expressed in neuroepithelial cells surrounding retinal axons, oligodendrocytes, the base of limb buds, the mesoderm surrounding cranial vessels , and the cardiac atrial septum and endocardial cushions, Human SEMA5A cDNA encodes a signal sequence, a extracellular domain (ECD), a transmembrane sequence and an cytoplasmic portion. SEMA5A mutations have been implicated in the genetic syndrome,cri-du-chat,while some polymorphisms may increase risk for neurodegenerative diseases such as Parkinson. The expression of SEMA5A may be upregulated in metastatic cancer cells and downregulated in autism. |