| Catalog# |
C292 |
| Source |
E.coli |
| Description |
Recombinant Human Signaling Threshold-Regulating Transmembrane Adapter 1/SIT1 is produced by our E. coli expression system. The target protein is expressed with sequence (Gln65-Ser196) of Human SIT1 fused with a 6His tag at the N-terminus. |
| Names |
Signaling Threshold-Regulating Transmembrane Adapter 1, SHP2-Interacting Transmembrane Adapter Protein, Suppression-Inducing Transmembrane Adapter 1, gp30/40, SIT1, SIT |
| Accession # |
Q9Y3P8 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 250mM Nacl, 2mM EDTA, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPD QQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVC AQTRRARASFPDQAYANSQPAASLEHHHHHH
|
| Background |
Signaling Threshold-Regulating Transmembrane Adapter 1 (SIT1) is a single-pass type I membrane protein and specifically expressed in T- and B-cells. SIT1 interacts with PTPN11/SHP2, GRB2 and CSK, when it is phosphorylated. SIT1 negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cell. In addition, SIT1 is involved in positive selection of T-cells. |
