| Catalog# |
C421 |
| Source |
HEK293 |
| Description |
Recombinant Human Acrosomal Protein SP-10/ACRV1 produced by transfected human cells is a secreted protein with sequence (Gln22-Ile265) of Human ACRV1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Acrosomal Protein SP-10, Acrosomal Vesicle Protein 1, ACRV1 |
| Accession # |
P26436 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSG EHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSG EQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQ CMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKIVDHHHHHH
|
| Background |
Acrosomal Protein SP-10 is a testis-specific differentiation antigen that is associated with acrosomal membranes and matrix of mature sperm. It has been detected in several species including humans. Acrosomal Protein SP-10 may be involved in sperm-zona binding or penetration as a potential contraceptive vaccine immunogen for humans. ACRV1 is also a intra-acrosomal protein that is considered to be a vaccine candidate for immunocontraception. |
